CACrown ArchivesThe cinema collection
Menu
Research dossier · General Reference

Epidermal growth factor

mammalian protein found in Homo sapiens

Cross-disciplinary reference desk with index cards, atlas, dictionary and catalogue
General referenceInterpretive dossier study · Crown Archives visual atlas
Record originEnglish Wikipedia
Text licenseCC BY-SA 4.0
Source revisionSep 20, 2026
Entity authorityQ424374
Source-derived summary

Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-kDa and has 53 amino acid residues and three intramolecular disulfide bonds.

EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets, submandibular gland (submaxillary gland), and parotid gland. Initially, human EGF was known as urogastrone.

Structure

In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).

Function

EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival.

Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents.

Biological sources

The Epidermal growth factor can be found in platelets, urine, saliva, milk, tears, and blood plasma.

Editorial summary

“Epidermal growth factor” enters the record as mammalian protein found in Homo sapiens. Crown Archives preserves that source wording while asking what Epidermal, growth and factor can confirm, complicate or overturn.

Editorial reviewA dependable orientation record for establishing vocabulary, names and a first evidence trail. The current 210-word lead offers orientation but no explicit four-digit date, so chronology should not be assumed. The selected authority fields contribute no independent date. Its strongest next move is a source search built around Epidermal, growth and factor.
Editorial analysis

Why this record matters

“Epidermal growth factor” is worth following because a concise public description often conceals a longer documentary argument. Here, Epidermal, growth and factor provides the most credible route into that argument.

Evidence profile

Named sources, stable identifiers and responsible institutions provide the strongest route from overview to verifiable evidence. The source revision retrieved here is dated Sep 20, 2026. The linked authority identifier is Q424374.

Critical limits

A concise general-reference account can conceal disagreements about scope, terminology or the weight assigned to individual sources. The lead is largely declarative, so disagreement and counter-evidence require a deliberate search beyond the opening account. Authority statements aid reconciliation but still require their own references, qualifiers and ranks to be checked.

How to read it

Use the entry as an orientation point, then follow its citations and revision history. Names, dates and institutional relationships should be checked against the original record.

Best used for
  • Subject orientation
  • Search vocabulary
  • Locating named sources
Verify next

The closest primary source, responsible institution and strongest cited specialist reference.

Three-step research path

  1. Establish the record: confirm the title “Epidermal growth factor”, its source revision and the description used here.
  2. Expand the search: follow Epidermal growth factor primary sources, Epidermal growth factor archive and Epidermal research across catalogues and specialist indexes.
  3. Test the account: compare the strongest cited source with the responsible institution’s current record and note any disagreement.

Questions for further research

  1. Which source most directly establishes the central claim about “Epidermal growth factor”?
  2. Which institution is responsible for the underlying evidence?
  3. What terminology or title could unlock a more precise catalogue search?
Subject index

Search terms from this dossier

Source & attribution

This entry incorporates text from Epidermal growth factor” on English Wikipedia. Contributors are listed in the page history. Text is available under the Creative Commons Attribution-ShareAlike 4.0 License. Selected authority identifiers and statements are retrieved from Wikidata under CC0; their references and qualifiers remain part of the verification path.