Cathelicidin antimicrobial peptide
protein-coding gene in the species Homo sapiens
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide
encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37.
The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human.
Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes.
Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous.
Begin with the source’s own compact description: “Cathelicidin antimicrobial peptide” is protein-coding gene in the species Homo sapiens. The dossier treats that line as a proposition to test through Cathelicidin, antimicrobial and peptide, not as a finished interpretation.
Why this record matters
The phrase “protein-coding gene in the species Homo sapiens” supplies a clear boundary for inquiry. It also exposes the unanswered questions: who defined that boundary, when it became stable and which sources sit outside it.
Datasets, specimens, observations and peer-reviewed methods provide the appropriate test for the technical claims summarized here. The source revision retrieved here is dated Sep 14, 2026. The linked authority identifier is Q24739493. None of the 0 selected statements returned an explicit reference.
Current terminology should not be projected backward without checking the classification used when the underlying evidence was created. The lead is largely declarative, so disagreement and counter-evidence require a deliberate search beyond the opening account. Authority statements aid reconciliation but still require their own references, qualifiers and ranks to be checked.
How to read it
Check terminology, classification and the date of the cited evidence. Scientific names and technical consensus can change while older records retain historical value.
- Current terminology
- Classification context
- Finding cited technical literature
Primary datasets, specimen catalogues, standards bodies and the most recent peer-reviewed literature.
Three-step research path
- Establish the record: confirm the title “Cathelicidin antimicrobial peptide”, its source revision and the description used here.
- Expand the search: follow Cathelicidin antimicrobial peptide primary sources, Cathelicidin antimicrobial peptide archive and Cathelicidin research across catalogues and specialist indexes.
- Test the account: compare the strongest cited source with the responsible institution’s current record and note any disagreement.
Questions for further research
- Which source most directly establishes the central claim about “Cathelicidin antimicrobial peptide”?
- Has classification or technical consensus changed since the cited source?
- Is the terminology current, historical or disputed?
Search terms from this dossier
This entry incorporates text from “Cathelicidin antimicrobial peptide” on English Wikipedia. Contributors are listed in the page history. Text is available under the Creative Commons Attribution-ShareAlike 4.0 License. Selected authority identifiers and statements are retrieved from Wikidata under CC0; their references and qualifiers remain part of the verification path.